PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim10g083340.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 410aa    MW: 45920.4 Da    PI: 6.957
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim10g083340.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.53.1e-334498155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprl+Wtp+LHerF+eav+qLGG++kAtPk++l+lm+++gLtl+h+kSHLQkYRl
  Sopim10g083340.0.1 44 KPRLKWTPDLHERFIEAVTQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRL 98
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.51741101IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-3142100IPR009057Homeodomain-like
SuperFamilySSF466891.79E-1643101IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-244499IPR006447Myb domain, plants
PfamPF002491.0E-94697IPR001005SANT/Myb domain
PfamPF143796.7E-15143183IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MYHHHHQASN MHPSTRMSFP ERHLFLQGGN ANGDSGLVLS TDAKPRLKWT PDLHERFIEA  60
VTQLGGADKA TPKSVLKLMG IQGLTLYHLK SHLQKYRLSK NHHGQANISG VNKAAASMEK  120
ICESTGSPKS NPSIGHQPNN NIPISEAIQM QIDVQRRLHE QLELRIEAQG KYLQAVLEKA  180
QETLGTQNLG TIGLEAAKVQ LSDLVSKVSN QCLNSAFSEI KELSGFHTPQ TQATQRLADC  240
SMDSCLTSSE GPLRDLQEMH NNQLGLRNLN FRPCTEEIEN QTRLQQTALR WRDDLKENRL  300
FPKIDEDTEK EFAKETNWSN LSMNVGIQGG KRNVNSSYVD ERLNGIDADI KLFHQTATDR  360
SDSTKPEKQV SPQEYKLPYF APKLDLNTDD QTDAASNCKQ LDLNGFSWN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755220.0HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249439.10.0PREDICTED: uncharacterized protein LOC101257914 isoform X3
RefseqXP_015089341.10.0PREDICTED: uncharacterized protein LOC107032271 isoform X2
TrEMBLK4D3C10.0K4D3C1_SOLLC; Uncharacterized protein
STRINGSolyc10g083340.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.11e-122G2-like family protein